SCOPe 2.08: Domain d3wg1b1: 3wg1 B:2-160

Lineage for d3wg1b1 (3wg1 B:2-160)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Agrocybe aegerita [TaxId:5400] [231694] (18 PDB entries)

8. Domain d3wg1b1: 3wg1 B:2-160 [233954]
   Other proteins in same PDB: d3wg1a2, d3wg1b2
   automated match to d3wg3a_

Details for d3wg1b1

PDB Entry: 3wg1, 1.9 Å

PDB Description: crystal structure of agrocybe cylindracea galectin with lactose

PDB Compounds: (B:) Galactoside-binding lectin

SCOPe Domain Sequences for d3wg1b1:

Sequence; same for both SEQRES and ATOM records:

>d3wg1b1 b.29.1.0 (B:2-160) automated matches {Agrocybe aegerita [TaxId: 5400]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgl

Timeline for d3wg1b1:

• d3wg1b1 first appeared in SCOPe 2.03, called d3wg1b_
  
• d3wg1b1 appears in SCOPe 2.07