SCOPe 2.04: Domain d3wd8c2: 3wd8 C:236-389

Lineage for d3wd8c2 (3wd8 C:236-389)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)

8. Domain d3wd8c2: 3wd8 C:236-389 [233953]
   automated match to d3wd8d2
   complexed with gol

Details for d3wd8c2

PDB Entry: 3wd8, 2.46 Å

PDB Description: TypeIII polyketide synthases

PDB Compounds: (C:) Type III polyketide synthase quinolone synthase

SCOPe Domain Sequences for d3wd8c2:

Sequence; same for both SEQRES and ATOM records:

>d3wd8c2 c.95.1.0 (C:236-389) automated matches {Citrus microcarpa [TaxId: 164113]}
lfhvvsstqmsvpdtnkfirahvkemgmelylskdvpatvgkniekllvdavspfgisdw
nslfysvhpggraildqvelnlglgkeklrasrhvlseygnmggssvyfildeirkksmq
eakpttgdglewgvlfaigpgltvetvillsvpi

Timeline for d3wd8c2:

• d3wd8c2 first appeared in SCOPe 2.03
  
• d3wd8c2 appears in SCOPe 2.05
  
• d3wd8c2 appears in the current release, SCOPe 2.08