SCOPe 2.03: Domain d3wd7a1: 3wd7 A:-11-235

Lineage for d3wd7a1 (3wd7 A:-11-235)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)

8. Domain d3wd7a1: 3wd7 A:-11-235 [233950]
   automated match to d3wd8d1
   complexed with coa, ni, so4

Details for d3wd7a1

PDB Entry: 3wd7, 2.35 Å

PDB Description: Type III polyketide synthase

PDB Compounds: (A:) Type III polyketide synthases acridone synthase

SCOPe Domain Sequences for d3wd7a1:

Sequence; same for both SEQRES and ATOM records:

>d3wd7a1 c.95.1.0 (A:-11-235) automated matches {Citrus microcarpa [TaxId: 164113]}
mrgshhhhhhgsmvtmeeirrakraeglatilaistatppncviqadypdyyfgitnseh
mtelkekfkllceksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgke
aatkaikewgqpksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyaga
tilrlakdlaennkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadp
dtsierp

Timeline for d3wd7a1:

• d3wd7a1 is new in SCOPe 2.03-stable
  
• d3wd7a1 appears in SCOPe 2.04
  
• d3wd7a1 appears in the current release, SCOPe 2.08