Lineage for d3wd7a1 (3wd7 A:1-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917527Species Citrus microcarpa [TaxId:164113] [227815] (2 PDB entries)
  8. 2917528Domain d3wd7a1: 3wd7 A:1-235 [233950]
    Other proteins in same PDB: d3wd7a3, d3wd7b3
    automated match to d3wd8d1
    complexed with coa, ni, so4

Details for d3wd7a1

PDB Entry: 3wd7 (more details), 2.35 Å

PDB Description: Type III polyketide synthase
PDB Compounds: (A:) Type III polyketide synthases acridone synthase

SCOPe Domain Sequences for d3wd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wd7a1 c.95.1.0 (A:1-235) automated matches {Citrus microcarpa [TaxId: 164113]}
mvtmeeirrakraeglatilaistatppncviqadypdyyfgitnsehmtelkekfkllc
eksmirkrhmclteeilkanpnmclymgtsldarqdislvevpklgkeaatkaikewgqp
ksnithlifctsagvdmpgadyqltrliglnpdvkrmmiyqqgcyagatilrlakdlaen
nkgsrvlvvcsentiptfrgpsythidslvgqalfadgaaalivgadpdtsierp

SCOPe Domain Coordinates for d3wd7a1:

Click to download the PDB-style file with coordinates for d3wd7a1.
(The format of our PDB-style files is described here.)

Timeline for d3wd7a1: