Lineage for d3wbre_ (3wbr E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1683001Domain d3wbre_: 3wbr E: [233948]
    automated match to d3wbra_

Details for d3wbre_

PDB Entry: 3wbr (more details), 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)
PDB Compounds: (E:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbre_:

Sequence, based on SEQRES records: (download)

>d3wbre_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickm

Sequence, based on observed residues (ATOM records): (download)

>d3wbre_ d.169.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrssewgwndihchvpqk
sickm

SCOPe Domain Coordinates for d3wbre_:

Click to download the PDB-style file with coordinates for d3wbre_.
(The format of our PDB-style files is described here.)

Timeline for d3wbre_: