SCOPe 2.03: Domain d3wbqb_: 3wbq B:

Lineage for d3wbqb_ (3wbq B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)

8. Domain d3wbqb_: 3wbq B: [233942]
   automated match to d3wbra_

Details for d3wbqb_

PDB Entry: 3wbq, 2.3 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-2)

PDB Compounds: (B:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbqb_:

Sequence, based on SEQRES records:

>d3wbqb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickm

Sequence, based on observed residues (ATOM records):

>d3wbqb_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsewgwndihchvpqks
ickm

Timeline for d3wbqb_:

• d3wbqb_ is new in SCOPe 2.03-stable
  
• d3wbqb_ appears in SCOPe 2.04
  
• d3wbqb_ appears in the current release, SCOPe 2.08