![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
![]() | Protein automated matches [190358] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries) |
![]() | Domain d3waod_: 3wao D: [233940] automated match to d3waoa_ |
PDB Entry: 3wao (more details), 2.6 Å
SCOPe Domain Sequences for d3waod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3waod_ d.15.1.3 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dfvmigspsektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflv pdhvnmselikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvya sqet
Timeline for d3waod_: