Lineage for d1ar92_ (1ar9 2:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (16 proteins) 
Protein Poliovirus [49666] (3 species) 
Species Poliovirus type 1, strain Mahoney [TaxId:12080] [49667] (11 PDB entries) 
Domain d1ar92_: 1ar9 2: [23394]
Details for d1ar92_
PDB Entry: 1ar9 (more details), 2.9 Å
PDB Description: p1/mahoney poliovirus, single site mutant h2142y
SCOP Domain Sequences for d1ar92_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ar92_ b.10.1.4 (2:) Poliovirus {Poliovirus type 1, strain Mahoney}
eacgysdrvlqltlgnstittqeaansvvaygrwpeylrdseanpvdqptepdvaacrfy
tldtvswtkesrgwwwklpdalrdmglfgqnmyyhylgrsgytvhvqcnaskfhqgalgv
favpemclagdsntttmytsyqnanpgekggtftgtftpdnnqtsparrfcpvdyllgng
tllgnafvfphqiinlrtnncatlvlpyvnslsidsmvkhnnwgiailplaplnfasess
peipitltiapmccefnglrnitlprlq
SCOP Domain Coordinates for d1ar92_:
Click to download the PDB-style file with coordinates for d1ar92_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ar92_:
- d1ar92_ first appeared (with stable ids) in SCOP 1.55
- d1ar92_ appears in SCOP 1.57
- d1ar92_ appears in SCOP 1.61
- d1ar92_ last appears in SCOP 1.63
View in 3D
