Lineage for d3w9db2 (3w9d B:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750681Domain d3w9db2: 3w9d B:108-212 [233938]
    Other proteins in same PDB: d3w9da_, d3w9db1, d3w9dc_, d3w9dd1
    automated match to d3w9eb2

Details for d3w9db2

PDB Entry: 3w9d (more details), 2.32 Å

PDB Description: structure of human monoclonal antibody e317 fab
PDB Compounds: (B:) antibody fab light chain

SCOPe Domain Sequences for d3w9db2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w9db2 b.1.1.2 (B:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhklyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3w9db2:

Click to download the PDB-style file with coordinates for d3w9db2.
(The format of our PDB-style files is described here.)

Timeline for d3w9db2: