Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (59 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:484021] [233931] (1 PDB entry) |
Domain d3w9sa_: 3w9s A: [233934] automated match to d2pl1a_ complexed with bef, mg |
PDB Entry: 3w9s (more details), 1.7 Å
SCOPe Domain Sequences for d3w9sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w9sa_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]} kilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedglh flsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallr
Timeline for d3w9sa_: