SCOPe 2.05: Domain d3w9sa_: 3w9s A:

Lineage for d3w9sa_ (3w9s A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:484021] [233931] (1 PDB entry)

8. Domain d3w9sa_: 3w9s A: [233934]
   automated match to d2pl1a_
   complexed with bef, mg

Details for d3w9sa_

PDB Entry: 3w9s, 1.7 Å

PDB Description: Crystal Structure Analysis of the N-terminal Receiver domain of Response Regulator PmrA

PDB Compounds: (A:) OmpR family response regulator in two-component regulatory system with BasS

SCOPe Domain Sequences for d3w9sa_:

Sequence; same for both SEQRES and ATOM records:

>d3w9sa_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
kilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedglh
flsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallr

Timeline for d3w9sa_:

• d3w9sa_ first appeared in SCOPe 2.03
  
• d3w9sa_ appears in SCOPe 2.04
  
• d3w9sa_ appears in SCOPe 2.06
  
• d3w9sa_ appears in the current release, SCOPe 2.08