Lineage for d3w9sb_ (3w9s B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438829Species Klebsiella pneumoniae [TaxId:484021] [233931] (1 PDB entry)
  8. 2438831Domain d3w9sb_: 3w9s B: [233933]
    automated match to d2pl1a_
    complexed with bef, mg

Details for d3w9sb_

PDB Entry: 3w9s (more details), 1.7 Å

PDB Description: Crystal Structure Analysis of the N-terminal Receiver domain of Response Regulator PmrA
PDB Compounds: (B:) OmpR family response regulator in two-component regulatory system with BasS

SCOPe Domain Sequences for d3w9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w9sb_ c.23.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}
kilvieddalllqglilamqsegyvcdgvstaheaalslasnhyslivldlglpdedglh
flsrmrrekmtqpvliltardtledrisgldtgaddylvkpfaleelnarirallrr

SCOPe Domain Coordinates for d3w9sb_:

Click to download the PDB-style file with coordinates for d3w9sb_.
(The format of our PDB-style files is described here.)

Timeline for d3w9sb_: