SCOPe 2.07: Domain d3w8lb_: 3w8l B:

Lineage for d3w8lb_ (3w8l B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (180 PDB entries)

8. Domain d3w8lb_: 3w8l B: [233929]
   automated match to d3w8la_
   complexed with i6p

Details for d3w8lb_

PDB Entry: 3w8l, 2.4 Å

PDB Description: crystal structure of human ck2 in complex with inositol hexakisphosphate

PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3w8lb_:

Sequence; same for both SEQRES and ATOM records:

>d3w8lb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
pvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeavnitnne
kvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytvvk

Timeline for d3w8lb_:

• d3w8lb_ first appeared in SCOPe 2.03
  
• d3w8lb_ appears in SCOPe 2.06
  
• d3w8lb_ appears in the current release, SCOPe 2.08