Lineage for d3w2ra_ (3w2r A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (101 PDB entries)
    Uniprot P00533 702-1018
  8. 2543520Domain d3w2ra_: 3w2r A: [233923]
    automated match to d3w2oa_
    complexed with edo, w2r; mutant

Details for d3w2ra_

PDB Entry: 3w2r (more details), 2.05 Å

PDB Description: EGFR Kinase domain T790M/L858R mutant with compound 4
PDB Compounds: (A:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3w2ra_:

Sequence, based on SEQRES records: (download)

>d3w2ra_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank
eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkvp
ikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqpp
ictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnf
yralmdeedmddvvdadeyl

Sequence, based on observed residues (ATOM records): (download)

>d3w2ra_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank
eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw
cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgraklvpikwmalesilhriy
thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcw
midadsrpkfreliiefskmardpqrylviqgdesnfyralmdeedmddvvdadeyl

SCOPe Domain Coordinates for d3w2ra_:

Click to download the PDB-style file with coordinates for d3w2ra_.
(The format of our PDB-style files is described here.)

Timeline for d3w2ra_: