Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species) PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [82796] (90 PDB entries) Uniprot P00533 702-1018 |
Domain d3w2qa1: 3w2q A:698-1017 [233922] Other proteins in same PDB: d3w2qa2 automated match to d3w2oa_ complexed with hki, mes; mutant |
PDB Entry: 3w2q (more details), 2.2 Å
SCOPe Domain Sequences for d3w2qa1:
Sequence, based on SEQRES records: (download)
>d3w2qa1 d.144.1.7 (A:698-1017) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkvp ikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqpp ictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnf yralmdeedmddvvdadeyl
>d3w2qa1 d.144.1.7 (A:698-1017) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} apnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkank eildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnw cvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaeekeyhaeggkvp ikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqpp ictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspmddvv dadeyl
Timeline for d3w2qa1: