Lineage for d3w2mb_ (3w2m B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091369Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2091448Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)
  8. 2091478Domain d3w2mb_: 3w2m B: [233919]
    automated match to d3w1aa_
    complexed with fmn, gol, nco, zro

Details for d3w2mb_

PDB Entry: 3w2m (more details), 1.58 Å

PDB Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-3-183
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w2mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w2mb_ c.1.4.1 (B:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

SCOPe Domain Coordinates for d3w2mb_:

Click to download the PDB-style file with coordinates for d3w2mb_.
(The format of our PDB-style files is described here.)

Timeline for d3w2mb_: