SCOPe 2.08: Domain d3vxqa2: 3vxq A:114-204

Lineage for d3vxqa2 (3vxq A:114-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3vxqa2: 3vxq A:114-204 [233891]
   Other proteins in same PDB: d3vxqa1, d3vxqb1, d3vxqb2, d3vxqd1, d3vxqe1, d3vxqe2
   automated match to d3vxqd2

Details for d3vxqa2

PDB Entry: 3vxq, 2 Å

PDB Description: H27-14 TCR specific for HLA-A24-Nef134-10

PDB Compounds: (A:) H27-14 TCR alpha chain

SCOPe Domain Sequences for d3vxqa2:

Sequence; same for both SEQRES and ATOM records:

>d3vxqa2 b.1.1.2 (A:114-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

Timeline for d3vxqa2:

• d3vxqa2 first appeared in SCOPe 2.03
  
• d3vxqa2 appears in SCOPe 2.07