SCOPe 2.08: Domain d3vxqa1: 3vxq A:1-113

Lineage for d3vxqa1 (3vxq A:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3vxqa1: 3vxq A:1-113 [233876]
   Other proteins in same PDB: d3vxqa2, d3vxqd2
   automated match to d3vxqd1

Details for d3vxqa1

PDB Entry: 3vxq, 2 Å

PDB Description: H27-14 TCR specific for HLA-A24-Nef134-10

PDB Compounds: (A:) H27-14 TCR alpha chain

SCOPe Domain Sequences for d3vxqa1:

Sequence; same for both SEQRES and ATOM records:

>d3vxqa1 b.1.1.0 (A:1-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqevtqipaalsvpegenlvlncsftdsaiynlqwfrqdpgkgltsllliqssqreqtsg
rlnasldkssgrstlyiaasqpgdsatylcavrmdssyklifgsgtrllvrpd

Timeline for d3vxqa1:

• d3vxqa1 first appeared in SCOPe 2.03
  
• d3vxqa1 appears in SCOPe 2.07