Lineage for d3vxga_ (3vxg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081410Species Candida parapsilosis [TaxId:5480] [224874] (3 PDB entries)
  8. 2081411Domain d3vxga_: 3vxg A: [233875]
    automated match to d3wg6c_

Details for d3vxga_

PDB Entry: 3vxg (more details), 1.7 Å

PDB Description: Crystal structure of conjugated polyketone reductase C2 from Candida Parapsilosis
PDB Compounds: (A:) Conjugated polyketone reductase C2

SCOPe Domain Sequences for d3vxga_:

Sequence, based on SEQRES records: (download)

>d3vxga_ c.1.7.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
snllpktfrtksgkeisialgtgtkwkqaqtindvstelvdnillglklgfrhidtaeay
ntqkevgealkrtdvprediwvttkyspgwgsikayskspsdsidkalaqlgvdyvdlfl
ihspfftteqthgytleqawealveakkagkvreigisnaaiphleklfaaspspeyypv
vnqiefhpflqnqsknivrfcqehgilveafsplaplarvetnalaetlkrlaekykkte
aqvllrytlqrgilpvttsskesrlkeslnlfdfeltdeevneinkigdanpyraffheq
fkdl

Sequence, based on observed residues (ATOM records): (download)

>d3vxga_ c.1.7.0 (A:) automated matches {Candida parapsilosis [TaxId: 5480]}
snllpktfrtksgkeisialgtgtkwkqaqtindvstelvdnillglklgfrhidtaeay
ntqkevgealkrtdvprediwvttkyspgayskspsdsidkalaqlgvdyvdlflihspf
ftteqthgytleqawealveakkagkvreigisnaaiphleklfaaspspeyypvvnqie
fhpflqnqsknivrfcqehgilveafsplaplarvetnalaetlkrlaekykkteaqvll
rytlqrgilpvttsskesrlkeslnlfdfeltdeevneinkigdanpyraffheqfkdl

SCOPe Domain Coordinates for d3vxga_:

Click to download the PDB-style file with coordinates for d3vxga_.
(The format of our PDB-style files is described here.)

Timeline for d3vxga_: