SCOPe 2.03: Domain d3vwwb_: 3vww B:

Lineage for d3vwwb_ (3vww B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)

8. Domain d3vwwb_: 3vww B: [233874]
   automated match to d4gwra_
   complexed with po4

Details for d3vwwb_

PDB Entry: 3vww, 1.93 Å

PDB Description: Crystal structure of a0-domain of P5 from H. sapiens

PDB Compounds: (B:) Protein disulfide-isomerase A6

SCOPe Domain Sequences for d3vwwb_:

Sequence; same for both SEQRES and ATOM records:

>d3vwwb_ c.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvieltpsnfnreviqsdslwlvefyapwcghcqrltpewkkaatalkdvvkvgavdad
khhslggqygvqgfptikifgsnknrpedyqggrtgeaivdaalsalrqlvkdrlg

Timeline for d3vwwb_:

• d3vwwb_ is new in SCOPe 2.03-stable
  
• d3vwwb_ appears in SCOPe 2.04
  
• d3vwwb_ appears in the current release, SCOPe 2.08