Class a: All alpha proteins [46456] (284 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (6 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [233868] (1 PDB entry) |
Domain d3vu8a2: 3vu8 A:349-500 [233869] Other proteins in same PDB: d3vu8a1 automated match to d2d5ba1 protein/RNA complex; complexed with mds, zn |
PDB Entry: 3vu8 (more details), 2.2 Å
SCOPe Domain Sequences for d3vu8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vu8a2 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 300852]} laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg lkeevrleeaerwglaeprpipeeapvlfpkk
Timeline for d3vu8a2: