Lineage for d3vu8a2 (3vu8 A:349-500)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2706014Species Thermus thermophilus HB8 [TaxId:300852] [233868] (1 PDB entry)
  8. 2706015Domain d3vu8a2: 3vu8 A:349-500 [233869]
    Other proteins in same PDB: d3vu8a1
    automated match to d2d5ba1
    protein/RNA complex; complexed with mds, zn

Details for d3vu8a2

PDB Entry: 3vu8 (more details), 2.2 Å

PDB Description: Metionyl-tRNA synthetase from Thermus thermophilus complexed with methionyl-adenylate analogue
PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d3vu8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vu8a2 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

SCOPe Domain Coordinates for d3vu8a2:

Click to download the PDB-style file with coordinates for d3vu8a2.
(The format of our PDB-style files is described here.)

Timeline for d3vu8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vu8a1