SCOPe 2.08: Domain d3vu8a2: 3vu8 A:349-500

Lineage for d3vu8a2 (3vu8 A:349-500)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [233868] (1 PDB entry)

8. Domain d3vu8a2: 3vu8 A:349-500 [233869]
   Other proteins in same PDB: d3vu8a1
   automated match to d2d5ba1
   protein/RNA complex; complexed with mds, zn

Details for d3vu8a2

PDB Entry: 3vu8, 2.2 Å

PDB Description: Metionyl-tRNA synthetase from Thermus thermophilus complexed with methionyl-adenylate analogue

PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d3vu8a2:

Sequence; same for both SEQRES and ATOM records:

>d3vu8a2 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

Timeline for d3vu8a2:

• d3vu8a2 first appeared in SCOPe 2.03
  
• d3vu8a2 appears in SCOPe 2.07