![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
![]() | Protein automated matches [190581] (10 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [233866] (1 PDB entry) |
![]() | Domain d3vu8a1: 3vu8 A:1-348 [233867] Other proteins in same PDB: d3vu8a2 automated match to d1a8ha2 protein/RNA complex; complexed with mds, zn |
PDB Entry: 3vu8 (more details), 2.2 Å
SCOPe Domain Sequences for d3vu8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vu8a1 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead
Timeline for d3vu8a1: