SCOPe 2.04: Domain d3vu8a1: 3vu8 A:1-348

Lineage for d3vu8a1 (3vu8 A:1-348)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (8 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [233866] (1 PDB entry)

8. Domain d3vu8a1: 3vu8 A:1-348 [233867]
   Other proteins in same PDB: d3vu8a2
   automated match to d1a8ha2
   protein/RNA complex; complexed with mds, zn

Details for d3vu8a1

PDB Entry: 3vu8, 2.2 Å

PDB Description: Metionyl-tRNA synthetase from Thermus thermophilus complexed with methionyl-adenylate analogue

PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d3vu8a1:

Sequence; same for both SEQRES and ATOM records:

>d3vu8a1 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

Timeline for d3vu8a1:

• d3vu8a1 first appeared in SCOPe 2.03
  
• d3vu8a1 appears in SCOPe 2.05
  
• d3vu8a1 appears in the current release, SCOPe 2.08