Lineage for d3vu8a1 (3vu8 A:1-348)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860283Protein automated matches [190581] (10 species)
    not a true protein
  7. 2860347Species Thermus thermophilus HB8 [TaxId:300852] [233866] (1 PDB entry)
  8. 2860348Domain d3vu8a1: 3vu8 A:1-348 [233867]
    Other proteins in same PDB: d3vu8a2
    automated match to d1a8ha2
    protein/RNA complex; complexed with mds, zn

Details for d3vu8a1

PDB Entry: 3vu8 (more details), 2.2 Å

PDB Description: Metionyl-tRNA synthetase from Thermus thermophilus complexed with methionyl-adenylate analogue
PDB Compounds: (A:) Methionine--tRNA ligase

SCOPe Domain Sequences for d3vu8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vu8a1 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOPe Domain Coordinates for d3vu8a1:

Click to download the PDB-style file with coordinates for d3vu8a1.
(The format of our PDB-style files is described here.)

Timeline for d3vu8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vu8a2