SCOPe 2.03: Domain d3vqla_: 3vql A:

Lineage for d3vqla_ (3vql A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (3 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries)

8. Domain d3vqla_: 3vql A: [233864]
   automated match to d3aaca_

Details for d3vqla_

PDB Entry: 3vql, 1.9 Å

PDB Description: Small heat shock protein hsp14.0 of C-terminal deletion variant

PDB Compounds: (A:) Small heat shock protein StHsp14.0

SCOPe Domain Sequences for d3vqla_:

Sequence; same for both SEQRES and ATOM records:

>d3vqla_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
krseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqneliieaereit
epgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripia

Timeline for d3vqla_:

• d3vqla_ is new in SCOPe 2.03-stable
  
• d3vqla_ appears in SCOPe 2.04
  
• d3vqla_ appears in the current release, SCOPe 2.08