SCOPe 2.06: Domain d3vlna1: 3vln A:3-102

Lineage for d3vlna1 (3vln A:3-102)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein automated matches [227019] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232826] (7 PDB entries)

8. Domain d3vlna1: 3vln A:3-102 [233861]
   Other proteins in same PDB: d3vlna2
   automated match to d1eema2
   complexed with act, asc, edo, gol, so4; mutant

Details for d3vlna1

PDB Entry: 3vln, 1.7 Å

PDB Description: human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid

PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d3vlna1:

Sequence; same for both SEQRES and ATOM records:

>d3vlna1 c.47.1.5 (A:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gesarslgkgsappgpvpegsiriysmrfspfaertrlvlkakgirhevininlknkpew
ffkknpfglvpvlensqgqliyesaitceyldeaypgkkl

Timeline for d3vlna1:

• d3vlna1 first appeared in SCOPe 2.03
  
• d3vlna1 appears in SCOPe 2.05
  
• d3vlna1 appears in SCOPe 2.07
  
• d3vlna1 appears in the current release, SCOPe 2.08