![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
![]() | Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
![]() | Protein automated matches [233857] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
![]() | Domain d3vi3c2: 3vi3 C:450-600 [233859] Other proteins in same PDB: d3vi3a1, d3vi3c1, d3vi3e1, d3vi3e2, d3vi3f_, d3vi3h_, d3vi3l1, d3vi3l2 automated match to d1m1xa1 complexed with ca, mg, nag |
PDB Entry: 3vi3 (more details), 2.9 Å
SCOPe Domain Sequences for d3vi3c2:
Sequence, based on SEQRES records: (download)
>d3vi3c2 b.1.15.0 (C:450-600) automated matches {Human (Homo sapiens) [TaxId: 9606]} pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelqldw qkqkggvrralflasrqatltqtlliqngaredcremkiylrnesefrdklspihialnf sldpqapvdshglrpalhyqsksriedkaqi
>d3vi3c2 b.1.15.0 (C:450-600) automated matches {Human (Homo sapiens) [TaxId: 9606]} pivsasasltifpamfnpeerscslegnpvacinlsfclnasgkhvadsigftvelqldw qkqralflasrqatltqtlliqngaredcremkiylrnelspihialnfsldpqapvdsh glrpalhyqsksriedkaqi
Timeline for d3vi3c2: