![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) ![]() |
![]() | Family b.69.8.0: automated matches [233848] (1 protein) not a true family |
![]() | Protein automated matches [233850] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [233851] (2 PDB entries) |
![]() | Domain d3vi3c1: 3vi3 C:1-449 [233853] Other proteins in same PDB: d3vi3a2, d3vi3c2, d3vi3e1, d3vi3e2, d3vi3l1, d3vi3l2 automated match to d1m1xa4 complexed with ca, mg, nag |
PDB Entry: 3vi3 (more details), 2.9 Å
SCOPe Domain Sequences for d3vi3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vi3c1 b.69.8.0 (C:1-449) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnldaeapavlsgppgsffgfsvefyrpgtdgvsvlvgapkantsqpgvlqggavylcpw gasptqctpiefdskgsrllesslsssegeepveykslqwfgatvrahgssilacaplys wrtekeplsdpvgtcylstdnftrileyapcrsdfswaagqgycqggfsaeftktgrvvl ggpgsyfwqgqilsatqeqiaesyypeylinlvqgqlqtrqassiyddsylgysvavgef sgddtedfvagvpkgnltygyvtilngsdirslynfsgeqmasyfgyavaatdvngdgld dllvgapllmdrtpdgrpqevgrvyvylqhpagieptptltltghdefgrfgssltplgd ldqdgyndvaigapfggetqqgvvfvfpggpgglgskpsqvlqplwaashtpdffgsalr ggrdldgngypdlivgsfgvdkavvyrgr
Timeline for d3vi3c1: