SCOPe 2.05: Domain d3vdga2: 3vdg A:139-423

Lineage for d3vdga2 (3vdg A:139-423)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [225618] (5 PDB entries)

8. Domain d3vdga2: 3vdg A:139-423 [233847]
   Other proteins in same PDB: d3vdga1
   automated match to d4it1d2
   complexed with act, cl, fmt, na

Details for d3vdga2

PDB Entry: 3vdg, 1.9 Å

PDB Description: crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate

PDB Compounds: (A:) Probable glucarate dehydratase

SCOPe Domain Sequences for d3vdga2:

Sequence; same for both SEQRES and ATOM records:

>d3vdga2 c.1.11.0 (A:139-423) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
gavrdavpfsaylfykwaahpgaepdgwgaaldpdgivaqarrmideygfsaiklkggvf
apeeemaavealraafpdhplrldpnaawtpqtsvkvaaglegvleyledptpgldgmae
vaaqapmplatnmcvvafdqlpaavaknsvqvvlsdhhywgglqrsrllagicdtfglgl
smhsnshlgislaamvhlaaatpnltyacdthwpwrhedvvapgalnfcdgevqvpatpg
lgveidedalaalheqylrcgirdrddtgymrsidpgfnasgprw

Timeline for d3vdga2:

• d3vdga2 first appeared in SCOPe 2.03
  
• d3vdga2 appears in SCOPe 2.04
  
• d3vdga2 appears in SCOPe 2.06
  
• d3vdga2 appears in the current release, SCOPe 2.08