Lineage for d3vdga1 (3vdg A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948345Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 2948352Domain d3vdga1: 3vdg A:1-138 [233846]
    Other proteins in same PDB: d3vdga2, d3vdga3
    automated match to d4it1d1
    complexed with act, cl, fmt, na

Details for d3vdga1

PDB Entry: 3vdg (more details), 1.9 Å

PDB Description: crystal structure of enolase msmeg_6132 (target efi-502282) from mycobacterium smegmatis str. mc2 155 complexed with formate and acetate
PDB Compounds: (A:) Probable glucarate dehydratase

SCOPe Domain Sequences for d3vdga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vdga1 d.54.1.0 (A:1-138) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mahnriritgarvtpvafadppllntvgvhqpyalraviqldtdagltglgetyadtvhl
erlqaaahaivgrsvfstnviralisdalggdrtgdgsglagmitsasvvdrvfspfeva
cldvqgqvtgrpvsdllg

SCOPe Domain Coordinates for d3vdga1:

Click to download the PDB-style file with coordinates for d3vdga1.
(The format of our PDB-style files is described here.)

Timeline for d3vdga1: