SCOPe 2.08: Domain d3vc5a1: 3vc5 A:1-133

Lineage for d3vc5a1 (3vc5 A:1-133)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Thermobispora bispora [TaxId:469371] [233840] (3 PDB entries)

8. Domain d3vc5a1: 3vc5 A:1-133 [233841]
   Other proteins in same PDB: d3vc5a2
   automated match to d4it1d1
   complexed with po4

Details for d3vc5a1

PDB Entry: 3vc5, 1.5 Å

PDB Description: crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with phosphate

PDB Compounds: (A:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3vc5a1:

Sequence; same for both SEQRES and ATOM records:

>d3vc5a1 d.54.1.0 (A:1-133) automated matches {Thermobispora bispora [TaxId: 469371]}
mlirevrvtpvafrdppllnaagvhqpwalrtivevvtdegitglgetygdlahleqvra
aaarlpgldvyalhriyrrvadvvganivtdmhgltgsssrvktvdrvfaafevacldiq
gkaagrpvadllg

Timeline for d3vc5a1:

• d3vc5a1 first appeared in SCOPe 2.03
  
• d3vc5a1 appears in SCOPe 2.07