Lineage for d3vada1 (3vad A:38-185)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732230Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1732270Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1732271Protein automated matches [230679] (2 species)
    not a true protein
  7. 1732286Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)
  8. 1732298Domain d3vada1: 3vad A:38-185 [233838]
    Other proteins in same PDB: d3vada2
    automated match to d1gkza1
    complexed with 0f1, adp, k, mg; mutant

Details for d3vada1

PDB Entry: 3vad (more details), 2.6 Å

PDB Description: Crystal structure of I170F mutant branched-chain alpha-ketoacid dehydrogenase kinase in complex with 3,6-dichlorobenzo[b]thiophene-2-carboxylic acid
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d3vada1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vada1 a.29.5.0 (A:38-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vrltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhe
lyirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvr
yfldktltsrlgfrmlathhlalhedkp

SCOPe Domain Coordinates for d3vada1:

Click to download the PDB-style file with coordinates for d3vada1.
(The format of our PDB-style files is described here.)

Timeline for d3vada1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vada2