Lineage for d3v9pa_ (3v9p A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849722Species Burkholderia thailandensis [TaxId:271848] [196068] (4 PDB entries)
  8. 1849723Domain d3v9pa_: 3v9p A: [233831]
    automated match to d3uxmb_
    complexed with act, gol, mrd, peg

Details for d3v9pa_

PDB Entry: 3v9p (more details), 1.9 Å

PDB Description: Crystal structure of Thymidylate kinase from Burkholderia thailandensis
PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d3v9pa_:

Sequence, based on SEQRES records: (download)

>d3v9pa_ c.37.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
argkfitfegidgagktthlqwfcdrlqerlgpagrhvvvtrepggtrlgetlreillnq
pmdleteallmfagrrehlalviepalargdwvvsdrftdatfayqgggrglprdkleal
erwvqggfqpdltvlfdvppqiasarrgavrmpdkfesesdaffartraeylrraqeaph
rfvivdssepiaqirkqlegvlaal

Sequence, based on observed residues (ATOM records): (download)

>d3v9pa_ c.37.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
argkfitfegidktthlqwfcdrlqerlgpagrhvvvtrepggtrlgetlreillnqpmd
leteallmfagrrehlalviepalargdwvvsdrftdatfayqgggrglprdklealerw
vqggfqpdltvlfdvppqiasarrgavrmpesesdaffartraeylrraqeaphrfvivd
ssepiaqirkqlegvlaal

SCOPe Domain Coordinates for d3v9pa_:

Click to download the PDB-style file with coordinates for d3v9pa_.
(The format of our PDB-style files is described here.)

Timeline for d3v9pa_: