Lineage for d3v61b2 (3v61 B:127-254)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2583354Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2583355Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2583540Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2583732Protein automated matches [227006] (3 species)
    not a true protein
  7. 2583747Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries)
  8. 2583759Domain d3v61b2: 3v61 B:127-254 [233830]
    Other proteins in same PDB: d3v61a_
    automated match to d1plqa2
    protein/DNA complex; complexed with ba, neq

Details for d3v61b2

PDB Entry: 3v61 (more details), 2.8 Å

PDB Description: structure of s. cerevisiae pcna conjugated to sumo on lysine 164
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d3v61b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v61b2 d.131.1.2 (B:127-254) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv
dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl
qfflapkf

SCOPe Domain Coordinates for d3v61b2:

Click to download the PDB-style file with coordinates for d3v61b2.
(The format of our PDB-style files is described here.)

Timeline for d3v61b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v61b1
View in 3D
Domains from other chains:
(mouse over for more information)
d3v61a_