Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins) duplication: consists of two domains of this fold |
Protein automated matches [227006] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233826] (5 PDB entries) |
Domain d3v61b2: 3v61 B:127-254 [233830] Other proteins in same PDB: d3v61a_ automated match to d1plqa2 protein/DNA complex; complexed with ba, neq |
PDB Entry: 3v61 (more details), 2.8 Å
SCOPe Domain Sequences for d3v61b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v61b2 d.131.1.2 (B:127-254) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gieelqydstlslpssefskivrdlsqlsdsinimitketikfvadgdigsgsviikpfv dmehpetsiklemdqpvdltfgakylldiikgsslsdrvgirlsseapalfqfdlksgfl qfflapkf
Timeline for d3v61b2: