SCOPe 2.07: Domain d3uyod_: 3uyo D:

Lineage for d3uyod_ (3uyo D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries)

8. Domain d3uyod_: 3uyo D: [233822]
   Other proteins in same PDB: d3uyoa_
   automated match to d2ck2a_
   complexed with so4

Details for d3uyod_

PDB Entry: 3uyo, 1.83 Å

PDB Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex

PDB Compounds: (D:) Monobody SH13

SCOPe Domain Sequences for d3uyod_:

Sequence; same for both SEQRES and ATOM records:

>d3uyod_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svssvptklevvaatptslliswdapavtvdfyvitygetggnspvqeftvpgskstati
sglspgvdytitvyagysdswnwpyspisinyrt

Timeline for d3uyod_:

• d3uyod_ first appeared in SCOPe 2.03
  
• d3uyod_ appears in SCOPe 2.06
  
• d3uyod_ appears in the current release, SCOPe 2.08