Lineage for d1c8ea_ (1c8e A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. Superfamily b.121.5: ssDNA viruses [88645] (4 families) (S)
  5. Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins)
    automatically mapped to Pfam PF00740
  6. Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. Species Feline parvovirus [TaxId:10785] [49663] (3 PDB entries)
  8. Domain d1c8ea_: 1c8e A: [23382]

Details for d1c8ea_

PDB Entry: 1c8e (more details), 3 Å

PDB Description: feline panleukopenia virus empty capsid structure
PDB Compounds: (A:) feline panleukopenia virus capsid

SCOPe Domain Sequences for d1c8ea_:

Sequence, based on SEQRES records: (download)

>d1c8ea_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Feline parvovirus [TaxId: 10785]}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
gysapyysfeastqgpfktpiaagrggaqtdenqaadgdpryafgrqhgqkttttgetpe
rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
lnnvppvypngqiwdkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasa
nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeks
qlaprkly

Sequence, based on observed residues (ATOM records): (download)

>d1c8ea_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Feline parvovirus [TaxId: 10785]}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
gysapyysfeastqgpfktpiaagdpryafgrqhgqkttttgetperftyiahqdtgryp
egdwiqninfnlpvtndnvllptdpiggktginytnifntygpltalnnvppvypngqiw
dkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasanmsrivtysdfwwk
gklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeksqlaprkly

SCOPe Domain Coordinates for d1c8ea_ are not available.

Timeline for d1c8ea_: