SCOPe 2.03: Domain d3uxkc2: 3uxk C:133-359

Lineage for d3uxkc2 (3uxk C:133-359)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins)

6. Protein automated matches [226997] (6 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228631] (4 PDB entries)

8. Domain d3uxkc2: 3uxk C:133-359 [233817]
   Other proteins in same PDB: d3uxka1, d3uxkb1, d3uxkc1, d3uxkd1
   automated match to d4hncb2
   complexed with bho, mg

Details for d3uxkc2

PDB Entry: 3uxk, 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue benzohydroxamate

PDB Compounds: (C:) mandelate racemase

SCOPe Domain Sequences for d3uxkc2:

Sequence; same for both SEQRES and ATOM records:

>d3uxkc2 c.1.11.2 (C:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

Timeline for d3uxkc2:

• d3uxkc2 is new in SCOPe 2.03-stable
  
• d3uxkc2 appears in SCOPe 2.04
  
• d3uxkc2 appears in the current release, SCOPe 2.08