| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein automated matches [226997] (13 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries) |
| Domain d3uxkd2: 3uxk D:133-359 [233815] Other proteins in same PDB: d3uxka1, d3uxkb1, d3uxkc1, d3uxkd1 automated match to d4hncb2 complexed with bho, mg |
PDB Entry: 3uxk (more details), 2.2 Å
SCOPe Domain Sequences for d3uxkd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uxkd2 c.1.11.2 (D:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
Timeline for d3uxkd2: