Lineage for d1c8fa_ (1c8f A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11637Protein Parvovirus (panleukopenia virus) capsid [49661] (2 species)
  7. 11638Species Host: cat (Felis domestica) [49663] (3 PDB entries)
  8. 11640Domain d1c8fa_: 1c8f A: [23381]

Details for d1c8fa_

PDB Entry: 1c8f (more details), 3 Å

PDB Description: feline panleukopenia virus empty capsid structure

SCOP Domain Sequences for d1c8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8fa_ b.10.1.4 (A:) Parvovirus (panleukopenia virus) capsid {Host: cat (Felis domestica)}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
gysapyysfeastqgpfktpiaagrggaqtdenqaadgdpryafgrqhgqkttttgetpe
rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
lnnvppvypngqiwdkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasa
nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeks
qlaprkly

SCOP Domain Coordinates for d1c8fa_:

Click to download the PDB-style file with coordinates for d1c8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1c8fa_: