Lineage for d3ux9d1 (3ux9 D:4-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356409Domain d3ux9d1: 3ux9 D:4-111 [233808]
    Other proteins in same PDB: d3ux9a_, d3ux9c_
    automated match to d3esvg1

Details for d3ux9d1

PDB Entry: 3ux9 (more details), 2.8 Å

PDB Description: Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus
PDB Compounds: (D:) ScFv antibody

SCOPe Domain Sequences for d3ux9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ux9d1 b.1.1.0 (D:4-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqppsvsgapgqrvtiscsgsssnigsnyvswyqqlpgtapklliydnnqrpsgvpd
rfsgsksgtsaslaitglqsedeadyycqvrdnnenewvfgggtkltv

SCOPe Domain Coordinates for d3ux9d1:

Click to download the PDB-style file with coordinates for d3ux9d1.
(The format of our PDB-style files is described here.)

Timeline for d3ux9d1: