SCOPe 2.08: Domain d3uwob_: 3uwo B:

Lineage for d3uwob_ (3uwo B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (13 PDB entries)

8. Domain d3uwob_: 3uwo B: [233807]
   automated match to d3uxmd_
   complexed with 0dj

Details for d3uwob_

PDB Entry: 3uwo, 1.7 Å

PDB Description: Structure Guided Development of Novel Thymidine Mimetics targeting Pseudomonas aeruginosa Thymidylate Kinase: from Hit to Lead Generation

PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d3uwob_:

Sequence, based on SEQRES records:

>d3uwob_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqaperyq
vldaglplaevqagldrllpnll

Sequence, based on observed residues (ATOM records):

>d3uwob_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
glfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepma
adtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaalesf
vqgdlrpdltlvfdlpvldrfeqedrrffeavrqtylqraaqaperyqvldaglplaevq
agldrllpnll

Timeline for d3uwob_:

• d3uwob_ first appeared in SCOPe 2.03
  
• d3uwob_ appears in SCOPe 2.07