SCOPe 2.07: Domain d3uv5a2: 3uv5 A:1519-1652

Lineage for d3uv5a2 (3uv5 A:1519-1652)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (51 PDB entries)

8. Domain d3uv5a2: 3uv5 A:1519-1652 [233806]
   Other proteins in same PDB: d3uv5a1
   automated match to d1eqfa2
   complexed with trs

Details for d3uv5a2

PDB Entry: 3uv5, 2.03 Å

PDB Description: Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1)

PDB Compounds: (A:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d3uv5a2:

Sequence; same for both SEQRES and ATOM records:

>d3uv5a2 a.29.2.1 (A:1519-1652) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni
skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd
ictakeaaleeael

Timeline for d3uv5a2:

• d3uv5a2 first appeared in SCOPe 2.03
  
• d3uv5a2 appears in SCOPe 2.06