Lineage for d3uv5a2 (3uv5 A:1519-1652)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706816Protein automated matches [190366] (2 species)
    not a true protein
  7. 2706817Species Human (Homo sapiens) [TaxId:9606] [187201] (46 PDB entries)
  8. 2706834Domain d3uv5a2: 3uv5 A:1519-1652 [233806]
    Other proteins in same PDB: d3uv5a1
    automated match to d1eqfa2
    complexed with trs

Details for d3uv5a2

PDB Entry: 3uv5 (more details), 2.03 Å

PDB Description: Crystal Structure of the tandem bromodomains of human Transcription initiation factor TFIID subunit 1 (TAF1)
PDB Compounds: (A:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d3uv5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uv5a2 a.29.2.1 (A:1519-1652) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni
skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd
ictakeaaleeael

SCOPe Domain Coordinates for d3uv5a2:

Click to download the PDB-style file with coordinates for d3uv5a2.
(The format of our PDB-style files is described here.)

Timeline for d3uv5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uv5a1