Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.5: ssDNA viruses [88645] (4 families) |
Family b.121.5.2: Parvoviridae-like VP [88646] (3 proteins) automatically mapped to Pfam PF00740 |
Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species) |
Species Feline parvovirus [TaxId:10785] [49663] (3 PDB entries) |
Domain d1c8ga_: 1c8g A: [23380] protein/DNA complex; complexed with ca |
PDB Entry: 1c8g (more details), 3 Å
SCOPe Domain Sequences for d1c8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8ga_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Feline parvovirus [TaxId: 10785]} gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev gysapyysfeastqgpfktpiaagrggaqtdenqaadgdpryafgrqhgqkttttgetpe rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta lnnvppvypngqiwdkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasa nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeks qlaprkly
Timeline for d1c8ga_: