Lineage for d1c8ga_ (1c8g A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076286Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 2076297Species Feline parvovirus [TaxId:10785] [49663] (3 PDB entries)
  8. 2076298Domain d1c8ga_: 1c8g A: [23380]
    protein/DNA complex; complexed with ca

Details for d1c8ga_

PDB Entry: 1c8g (more details), 3 Å

PDB Description: feline panleukopenia virus empty capsid structure
PDB Compounds: (A:) feline panleukopenia virus capsid

SCOPe Domain Sequences for d1c8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ga_ b.121.5.2 (A:) Parvovirus (panleukopenia virus) capsid protein {Feline parvovirus [TaxId: 10785]}
gvgistgtfnnqtefkflengwveitanssrlvhlnmpesenykrvvvnnmdktavkgnm
alddihveivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptnvyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegatnfgdigvqqdkrrgvtqmgntdyiteatimrpaev
gysapyysfeastqgpfktpiaagrggaqtdenqaadgdpryafgrqhgqkttttgetpe
rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
lnnvppvypngqiwdkefdtdlkprlhinapfvcqnncpgqlfvkvapnltnqydpdasa
nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpnnigamkivyeks
qlaprkly

SCOPe Domain Coordinates for d1c8ga_:

Click to download the PDB-style file with coordinates for d1c8ga_.
(The format of our PDB-style files is described here.)

Timeline for d1c8ga_: