SCOPe 2.06: Domain d3uknc_: 3ukn C:

Lineage for d3uknc_ (3ukn C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (14 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [233796] (3 PDB entries)

8. Domain d3uknc_: 3ukn C: [233799]
   automated match to d4l11a_

Details for d3uknc_

PDB Entry: 3ukn, 2.2 Å

PDB Description: Structure of the C-linker/CNBHD of zELK channels in C 2 2 21 space group

PDB Compounds: (C:) Novel protein similar to vertebrate potassium voltage-gated channel, subfamily H (Eag-related) family

SCOPe Domain Sequences for d3uknc_:

Sequence, based on SEQRES records:

>d3uknc_ b.82.3.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
rslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradia
mhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevl
kdntvlailgkgdligsdsltkeqviktnanvkaltycdlqyislkglrevlrlypeyaq
kfvseiqhdltynlr

Sequence, based on observed residues (ATOM records):

>d3uknc_ b.82.3.0 (C:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
rslyhtrtkdlkdfirvhrlpkalaqrmlecfqttwsvnngidvsellkdfpdelradia
mhlnkellqlplfesasrgclrslsliiktsfcapgeflirqgdalqaiyfvcsgsmevl
kvlailgkgdligsdsltqviktnanvkaltycdlqyislkglrevlrlypeyaqkiqhd
ltynlr

Timeline for d3uknc_:

• d3uknc_ first appeared in SCOPe 2.03
  
• d3uknc_ appears in SCOPe 2.05
  
• d3uknc_ appears in SCOPe 2.07
  
• d3uknc_ appears in the current release, SCOPe 2.08