Lineage for d3ukga2 (3ukg A:446-601)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692173Family a.4.1.6: DNA-binding domain of rap1 [46753] (3 proteins)
    duplication: consist of two domains of this fold
  6. 2692182Protein automated matches [233793] (1 species)
    not a true protein
  7. 2692183Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233794] (1 PDB entry)
  8. 2692184Domain d3ukga2: 3ukg A:446-601 [233795]
    Other proteins in same PDB: d3ukga1
    automated match to d1igna2
    protein/DNA complex; complexed with ca

Details for d3ukga2

PDB Entry: 3ukg (more details), 2.95 Å

PDB Description: Crystal structure of Rap1/DNA complex
PDB Compounds: (A:) DNA-binding protein RAP1

SCOPe Domain Sequences for d3ukga2:

Sequence, based on SEQRES records: (download)

>d3ukga2 a.4.1.6 (A:446-601) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrslitdedtptaiarrnmtmdpnhvpgs
epnfaayrtqsrrgpiareffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaek
aqnrepepmknltnrpkrpgvptpgnynsaakrarn

Sequence, based on observed residues (ATOM records): (download)

>d3ukga2 a.4.1.6 (A:446-601) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
krkfsadedytlaiavkkqfyrdlfqidpdtgrspnhvpgsepnfaayrtqsrrgpiare
ffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaekaqnrepepmknltnrpkrp
gvptpgnynsaakrarn

SCOPe Domain Coordinates for d3ukga2:

Click to download the PDB-style file with coordinates for d3ukga2.
(The format of our PDB-style files is described here.)

Timeline for d3ukga2: