![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.6: DNA-binding domain of rap1 [46753] (3 proteins) duplication: consist of two domains of this fold |
![]() | Protein automated matches [233793] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233794] (1 PDB entry) |
![]() | Domain d3ukga2: 3ukg A:446-601 [233795] Other proteins in same PDB: d3ukga1 automated match to d1igna2 protein/DNA complex; complexed with ca |
PDB Entry: 3ukg (more details), 2.95 Å
SCOPe Domain Sequences for d3ukga2:
Sequence, based on SEQRES records: (download)
>d3ukga2 a.4.1.6 (A:446-601) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} krkfsadedytlaiavkkqfyrdlfqidpdtgrslitdedtptaiarrnmtmdpnhvpgs epnfaayrtqsrrgpiareffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaek aqnrepepmknltnrpkrpgvptpgnynsaakrarn
>d3ukga2 a.4.1.6 (A:446-601) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} krkfsadedytlaiavkkqfyrdlfqidpdtgrspnhvpgsepnfaayrtqsrrgpiare ffkhfaeehaahtenawrdrfrkfllaygiddyisyyeaekaqnrepepmknltnrpkrp gvptpgnynsaakrarn
Timeline for d3ukga2: