Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (11 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [233791] (1 PDB entry) |
Domain d3ukga1: 3ukg A:360-445 [233792] Other proteins in same PDB: d3ukga2 automated match to d1igna1 protein/DNA complex; complexed with ca |
PDB Entry: 3ukg (more details), 2.95 Å
SCOPe Domain Sequences for d3ukga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ukga1 a.4.1.0 (A:360-445) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} kasftdeedefildvvrknptrrtthtlydeishyvpnhtgnsirhrfrvylskrleyvy evdkfgklvrdddgnliktkvlppsi
Timeline for d3ukga1: