SCOPe 2.08: Domain d3ukga1: 3ukg A:360-445

Lineage for d3ukga1 (3ukg A:360-445)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233791] (2 PDB entries)

8. Domain d3ukga1: 3ukg A:360-445 [233792]
   Other proteins in same PDB: d3ukga2
   automated match to d1igna1
   protein/DNA complex; complexed with ca

Details for d3ukga1

PDB Entry: 3ukg, 2.95 Å

PDB Description: Crystal structure of Rap1/DNA complex

PDB Compounds: (A:) DNA-binding protein RAP1

SCOPe Domain Sequences for d3ukga1:

Sequence; same for both SEQRES and ATOM records:

>d3ukga1 a.4.1.0 (A:360-445) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kasftdeedefildvvrknptrrtthtlydeishyvpnhtgnsirhrfrvylskrleyvy
evdkfgklvrdddgnliktkvlppsi

Timeline for d3ukga1:

• d3ukga1 first appeared in SCOPe 2.03
  
• d3ukga1 appears in SCOPe 2.07