Lineage for d1ijsp_ (1ijs P:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076286Protein Parvovirus (panleukopenia virus) capsid protein [49661] (6 species)
  7. 2076287Species Canine parvovirus [TaxId:10788] [49662] (7 PDB entries)
  8. 2076294Domain d1ijsp_: 1ijs P: [23379]
    protein/DNA complex; mutant

Details for d1ijsp_

PDB Entry: 1ijs (more details), 3.25 Å

PDB Description: cpv (strain d) mutant a300d, complex (viral coat/dna), vp2, ph=7.5, t=4 degrees c
PDB Compounds: (P:) protein (parvovirus coat protein)

SCOPe Domain Sequences for d1ijsp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijsp_ b.121.5.2 (P:) Parvovirus (panleukopenia virus) capsid protein {Canine parvovirus [TaxId: 10788]}
gvgistgtfnnqtefkflengwvyitanssrlvhlnmpesenyrrvvvnnmdktavngnm
alddihaeivtpwslvdanawgvwfnpgdwqlivntmselhlvsfeqeifnvvlktvses
atqpptkvynndltaslmvaldsnntmpftpaamrsetlgfypwkptiptpwryyfqwdr
tlipshtgtsgtptniyhgtdpddvqfytiensvpvhllrtgdefatgtfffdckpcrlt
htwqtnralglppflnslpqsegdtnfgdigvqqdkrrgvtqmgntnyiteatimrpaev
gysapyysfeastqgpfktpiaagrggaqtdenqaadgnpryafgrqhgqkttttgetpe
rftyiahqdtgrypegdwiqninfnlpvtndnvllptdpiggktginytnifntygplta
lnnvppvypngqiwdkefdtdlkprlhvnapfvcqnncpgqlfvkvapnltnqydpdasa
nmsrivtysdfwwkgklvfkaklrashtwnpiqqmsinvdnqfnyvpsniggmkivyeks
qlaprkly

SCOPe Domain Coordinates for d1ijsp_:

Click to download the PDB-style file with coordinates for d1ijsp_.
(The format of our PDB-style files is described here.)

Timeline for d1ijsp_: