Lineage for d3ueqa2 (3ueq A:555-628)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1328473Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1328474Protein automated matches [226835] (18 species)
    not a true protein
  7. 1328512Species Neisseria polysaccharea [TaxId:489] [226281] (5 PDB entries)
  8. 1328513Domain d3ueqa2: 3ueq A:555-628 [233788]
    Other proteins in same PDB: d3ueqa1
    automated match to d1g5aa1
    complexed with btu, otu, peg

Details for d3ueqa2

PDB Entry: 3ueq (more details), 1.85 Å

PDB Description: Crystal structure of amylosucrase from Neisseria polysaccharea in complex with turanose
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d3ueqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ueqa2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

SCOPe Domain Coordinates for d3ueqa2:

Click to download the PDB-style file with coordinates for d3ueqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ueqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ueqa1